PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc00539.1.g00480.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family HSF
Protein Properties Length: 118aa    MW: 13100.8 Da    PI: 9.0223
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc00539.1.g00480.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind85.28.7e-2741103264
                                   HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHHTTEEE CS
                  HSF_DNA-bind   2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnmYgFkk 64 
                                   Fl+k+y++++d++++++isw+++g++fvv+ + efa+++LpkyFkh+nf+SFvRQLn+Y  ++
  Zmw_sc00539.1.g00480.1.sm.mk  41 FLTKTYQLVDDPAVNDIISWNDDGSAFVVWRPAEFARDLLPKYFKHNNFSSFVRQLNTYVSRR 103
                                   9**********************************************************6655 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.101.4E-2932105IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004151.8E-3037117IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467852.27E-2538106IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004473.8E-2341105IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.0E-184164IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.0E-187991IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000563.0E-1892104IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 118 aa     Download sequence    Send to blast
MAAEQPAGEP SPPPLPSAHP PAPAERAPSP LASQRSVPTP FLTKTYQLVD DPAVNDIISW  60
NDDGSAFVVW RPAEFARDLL PKYFKHNNFS SFVRQLNTYV SRRVATSFIF SHLVSLRP
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d5u_B5e-19201051593Heat shock factor protein 1
5d5v_B5e-19201051593Heat shock factor protein 1
5d5v_D5e-19201051593Heat shock factor protein 1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001149902.12e-42heat shock factor protein 7
RefseqXP_008677301.12e-42PREDICTED: heat shock factor protein 7 isoform X1
SwissprotQ652B01e-41HFB2C_ORYSJ; Heat stress transcription factor B-2c
SwissprotQ6Z9C84e-42HFB2B_ORYSJ; Heat stress transcription factor B-2b
TrEMBLB8AMF06e-43B8AMF0_ORYSI; Putative uncharacterized protein
TrEMBLK7U3Z49e-43K7U3Z4_MAIZE; Uncharacterized protein
STRINGBGIOSGA011509-PA2e-42(Oryza sativa Indica Group)
STRINGGRMZM2G098696_P023e-42(Zea mays)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP12137394